pnas.1322269111 YARS Recombinant Protein Antigen Summary Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human YARS.Source: E.coliAmino Acid Sequence: GNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPMAKGPAKNSEPEEVIPSRLDIRVGKIITVEKHPDAD Source E. coli Protein/Peptide Type Recombinant…
j.ijpharm.2014.01.009 WIRE Recombinant Protein Antigen Summary Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WIPF2.Source: E.coliAmino Acid Sequence: MQRPSLPDLSRPNTTSSTGMKHSSSAPPPPPPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAPP Source E. coli Protein/Peptide Type Recombinant…
1472-6882-14-33 SLC6A17 Recombinant Protein Antigen Summary Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC6A17.Source: E.coliAmino Acid Sequence: MNEKCVVENAEKILGYLNTNVLSRDLIPPHVNFSHLTTKDYMEMYNVIMTVKEDQFSALGLDPCLLEDELDKSVQGTGLAFIAFTEAMTHFPASPFWSV Source E. coli Protein/Peptide Type Recombinant…
pnas.1323761111 ARSE Recombinant Protein Antigen Summary Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARSE.Source: E.coliAmino Acid Sequence: FVGALIVHADCFLMRNHTITEQPMCFQRTTPLILQEV Source E. coli Protein/Peptide Type Recombinant…
cddis.2013.552 TLL1 Recombinant Protein Antigen Summary Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TLL1.Source: E.coliAmino Acid Sequence: GLDYDYTFDGNEEDKTETIDYKDPCKAA Source E. coli Protein/Peptide Type Recombinant…
Ive . . . 4: Confounding elements for folks with ABI1: Beliefs for social care Disabled individuals are vulnerable and should really be taken care of by trained professionalsVulnerable people…
Hypothesis, most regression coefficients of meals insecurity patterns on linear slope variables for male young children (see initially column of Table 3) have been not statistically Elacridar site significant at…
Two TALE recognition sites is known to tolerate a degree of flexibility(8?0,29), we included in our search any DNA Danusertib site spacer size from 9 to 30 bp. Using these…
Made use of in show that in most circumstances VM and FM perform significantly superior. Most applications of MDR are realized in a retrospective design. As a result, cases are…
Nce to hormone therapy, thereby requiring additional aggressive remedy. For HER2+ breast cancers, treatment together with the targeted inhibitor trastuzumab may be the typical course.45,46 Even though trastuzumab is effective,…